PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0399.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 692aa    MW: 76772 Da    PI: 6.4675
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0399.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.8e-192879556
                         SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++t++q+++Le+ F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Bostr.7128s0399.1.p 28 HRHTHHQIQRLESTFNECQHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQKK 79
                         689**********************************************988 PP

2START152.63.4e-482184392206
                          HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SE CS
                START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddke...qWdetlak 78 
                          +a +a++el+++ + +ep+W       + +n + +  +f++s +       +++ea+r s vv+ ++ +lv  l+d+++    +   +a+
  Bostr.7128s0399.1.p 218 IAVTAMEELLRLLQTNEPLWINTDgcrDVLNLESYENIFPRSSSsggkknnFRMEASRSSSVVFTNALTLVDMLMDSGKsaeLFPSIVAA 307
                          6889******************99999999999999***99988999*******************************99999******* PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                           +tl+vissg       al+lm  elq+lsplv+ R+f ++Ry++q + g+w+i+ vS + +q++++     R+ ++pSg+li++++ng+
  Bostr.7128s0399.1.p 308 SKTLAVISSGlrgnhgDALHLMIEELQVLSPLVAtREFCVLRYCQQIEHGTWAIANVSYEFPQFVSQ----SRSYRFPSGCLIQDMPNGY 393
                          *****************************************************************95....56666************** PP

                          EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          skvtwvehv+ +++ p h++++  v++gla+ga +w atlqr ce+
  Bostr.7128s0399.1.p 394 SKVTWVEHVEFEEQEPiHEIFKDSVHKGLAFGAERWIATLQRMCER 439
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-191081IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-201075IPR009057Homeodomain-like
PROSITE profilePS5007117.6372181IPR001356Homeobox domain
SMARTSM003891.8E-172285IPR001356Homeobox domain
CDDcd000861.03E-172882No hitNo description
PfamPF000461.7E-162879IPR001356Homeobox domain
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PROSITE profilePS5084848.886208442IPR002913START domain
SuperFamilySSF559612.09E-32209440No hitNo description
CDDcd088752.52E-108212438No hitNo description
SMARTSM002347.8E-37217439IPR002913START domain
PfamPF018521.4E-40218439IPR002913START domain
Gene3DG3DSA:3.30.530.202.6E-9269438IPR023393START-like domain
SuperFamilySSF559613.69E-19461682No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010091Biological Processtrichome branching
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MNMEFFGDSQ NHDGSETEKK NKKKKRFHRH THHQIQRLES TFNECQHPDE KQRNQLSREL  60
GLAPRQIKFW FQNRRTQKKA QHERADNCAL KEENDKIRCE NIAIREAIKH ANCPNCGDSP  120
VNEDSYFDEQ KLRIENAQLR DELERVSSIA AKFIGRPISH LPPLLNPMHV SPLELFHSGP  180
SLDFDLLPGS CSSMAVPNLP SQPNLVLSEM DKSLMTNIAV TAMEELLRLL QTNEPLWINT  240
DGCRDVLNLE SYENIFPRSS SSGGKKNNFR MEASRSSSVV FTNALTLVDM LMDSGKSAEL  300
FPSIVAASKT LAVISSGLRG NHGDALHLMI EELQVLSPLV ATREFCVLRY CQQIEHGTWA  360
IANVSYEFPQ FVSQSRSYRF PSGCLIQDMP NGYSKVTWVE HVEFEEQEPI HEIFKDSVHK  420
GLAFGAERWI ATLQRMCERF TNLLEPATSS LDLGGVIPSA EGKRSIMRLA HRMVSNFCLS  480
VGTSNNTCST VVSGLDEFAI RVTSHKSRHE PNGMVLCAAT SFWLPISPQN VFNFLKDERT  540
RPQWDVLSNG NSVQEVANIA NGSNPGNCIS VLRGFNASSS QNNMLILQES CIDSSSAALV  600
IYTPLDLPAL NIAMSGQDTS CIPILPSGFA ISPDGSSKGG EGGSLITVGF QIMVSGLQPA  660
KLNMESMETV NNLINTTVHQ IKTTLNCPST A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934650.0AB493465.1 Arabidopsis thaliana At1g17920 mRNA for hypothetical protein, partial cds, clone: RAAt1g17920.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010476956.10.0PREDICTED: homeobox-leucine zipper protein HDG12
SwissprotQ9LMT80.0HDG12_ARATH; Homeobox-leucine zipper protein HDG12
TrEMBLR0IBH00.0R0IBH0_9BRAS; Uncharacterized protein
STRINGAT1G17920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0homeodomain GLABROUS 12